DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and rlc1

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_594364.1 Gene:rlc1 / 2543545 PomBaseID:SPAC926.03 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:171 Identity:58/171 - (33%)
Similarity:96/171 - (56%) Gaps:3/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKN 66
            ||..|:.:|... :.|:||:|..||....:||.|.||||.::|::.||.:.:||:..||.||.::
pombe    17 SSNTTSSQRVAA-QAAKRASSGAFAQLTSSQIQELKEAFALLDKDGDGNIGREDVKTMLTSLNQD 80

  Fly    67 PTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTT 131
            .::|.::.|......|||...|||..|..|....|.:.:..||..||:...|.:|...:|:.|::
pombe    81 ASEDSINHMFESINPPINLAAFLTAMGSMLCRISPRNDLLEAFSTFDDTQSGKIPISTMRDALSS 145

  Fly   132 MGDRFTDEDVDEMYREAPIKNGLFDYLEFTRILKHGAKDKD 172
            ||||...::|:.:.| :...:|:|.|.:|...:. |:||.:
pombe   146 MGDRMDPQEVESILR-SYTSHGVFYYEKFVDAIA-GSKDSN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 52/154 (34%)
rlc1NP_594364.1 FRQ1 35..183 CDD:227455 50/149 (34%)
EFh 49..106 CDD:238008 22/56 (39%)
EFh 118..178 CDD:298682 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3081
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51980
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 1 1.000 - - oto100448
orthoMCL 1 0.900 - - OOG6_103056
Panther 1 1.100 - - LDO PTHR23049
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.