DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and mlc-2

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_510828.1 Gene:mlc-2 / 181775 WormBaseID:WBGene00003370 Length:170 Species:Caenorhabditis elegans


Alignment Length:164 Identity:74/164 - (45%)
Similarity:108/164 - (65%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTDDYLDG 74
            :|..||.:::.:.:..|.|||..|.||||||.::|||:||.::|.||.|:.||:|:...|..:|.
 Worm     3 KAAKKKSSKKRSGSEAAQFDQKTIQEFKEAFGIMDQNKDGIIDKSDLKDLYASMGQIAPDSQIDA 67

  Fly    75 MMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL-TTMGDRFTD 138
            |:.||.||||||:|||||||||.|||||..|..||..||:::.|.:.||.|.::| ...|:...:
 Worm    68 MIKEASGPINFTVFLTLFGERLTGTDPEATIVGAFAMFDKKDCGKIKEDDLIKILQNKRGEPLDE 132

  Fly   139 EDVDEMYR-EAPIKNGLFDYLEFTRILKHGAKDK 171
            ::|..||: :.||:.|..||..|..::..||:|:
 Worm   133 DEVKAMYKGKPPIEGGEVDYKAFAHLITTGAQDE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 71/156 (46%)
mlc-2NP_510828.1 FRQ1 13..159 CDD:227455 68/145 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I4764
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.