DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and MYL6B

DIOPT Version :10

Sequence 1:NP_511057.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_002466.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:155 Identity:51/155 - (32%)
Similarity:80/155 - (51%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTD-DYLDGMMNEAPGP--- 82
            |.|...|::.|:.||||||.:.|:..||.:......|::.:||:|||: :.|..:.|.....   
Human    55 SKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKS 119

  Fly    83 --INFTMFLTLF----GERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDV 141
              ::|..||.:.    ..|.||| .||.:: .|..||:|..|.:....||.:|||:|::.|:|:|
Human   120 RRVDFETFLPMLQAVAKNRGQGT-YEDYLE-GFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEV 182

  Fly   142 DEMYREAPIKNGLFDYLEFTRILKH 166
            :.:.......||..:|..|   |||
Human   183 ETVLAGHEDSNGCINYEAF---LKH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_511057.1 PTZ00184 27..164 CDD:185504 46/146 (32%)
MYL6BNP_002466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 49/152 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.