DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and MYL12A

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001289978.1 Gene:MYL12A / 10627 HGNCID:16701 Length:177 Species:Homo sapiens


Alignment Length:174 Identity:140/174 - (80%)
Similarity:156/174 - (89%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |||::|   :..||||.|||||||||||||:||.||||||||||||||||::|||||||||||||
Human     7 MSSKRT---KTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGK 68

  Fly    66 NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLT 130
            ||||:|||.||||||||||||||||:|||:|.||||||||:|||.|||||..|.:.||.||||||
Human    69 NPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLT 133

  Fly   131 TMGDRFTDEDVDEMYREAPI-KNGLFDYLEFTRILKHGAKDKDE 173
            |||||||||:|||:|||||| |.|.|:|:||||||||||||||:
Human   134 TMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 130/155 (84%)
MYL12ANP_001289978.1 FRQ1 24..174 CDD:227455 125/149 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10246
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2839
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51980
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 1 1.000 - - otm40303
orthoMCL 1 0.900 - - OOG6_103056
Panther 1 1.100 - - LDO PTHR23049
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4770
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.