DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and MYL12B

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001138416.1 Gene:MYL12B / 103910 HGNCID:29827 Length:172 Species:Homo sapiens


Alignment Length:174 Identity:141/174 - (81%)
Similarity:155/174 - (89%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |||:|  .:..|||||.|||||||||||||:||.||||||||||||||||::|||||||||||||
Human     1 MSSKK--AKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGK 63

  Fly    66 NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLT 130
            ||||.|||.||||||||||||||||:|||:|.||||||||:|||.|||||..|.:.||.||||||
Human    64 NPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLT 128

  Fly   131 TMGDRFTDEDVDEMYREAPI-KNGLFDYLEFTRILKHGAKDKDE 173
            |||||||||:|||:|||||| |.|.|:|:||||||||||||||:
Human   129 TMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 130/155 (84%)
MYL12BNP_001138416.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 12/20 (60%)
FRQ1 19..169 CDD:227455 125/149 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10246
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68515
Inparanoid 1 1.050 287 1.000 Inparanoid score I2839
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51980
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 1 1.000 - - otm40303
orthoMCL 1 0.900 - - OOG6_103056
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4770
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.