DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl2a

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001373733.1 Gene:myl2a / 100537244 ZFINID:ZDB-GENE-120917-2 Length:169 Species:Danio rerio


Alignment Length:163 Identity:82/163 - (50%)
Similarity:116/163 - (71%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMN 77
            |:.|:.|.||||:||:||||.||||||.::|||||||::|.||.|..|:||: |...:.:|.|:.
Zfish     8 KRAAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRLNVKQEEIDEMLK 72

  Fly    78 EAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVD 142
            ||.||||||:|||:|||:|:|.|||:.|.|||..||.|..|:|.::.:.|:|||..|||:.|:::
Zfish    73 EASGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGILKKEYVTEMLTTQADRFSPEEME 137

  Fly   143 EMYRE-APIKNGLFDYLEFTRILKHGAKDKDEQ 174
            :|:.. .|...|..||.....|:.|| ::||::
Zfish   138 QMFSAFPPDAAGNLDYKNLVHIITHG-EEKDQE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 79/156 (51%)
myl2aNP_001373733.1 FRQ1 16..164 CDD:227455 77/148 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.