DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl2

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001107717.1 Gene:myl2 / 100135705 XenbaseID:XB-GENE-482091 Length:167 Species:Xenopus tropicalis


Alignment Length:175 Identity:89/175 - (50%)
Similarity:121/175 - (69%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            ||.:|       .||||:.|.||||:||:|.||.||||||.::|||||||::||||.|..|:||:
 Frog     1 MSPKK-------AKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGR 58

  Fly    66 -NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
             |..::.|:.|:.|||||||||:|||:|||:|:|.|||:.|.|||..||.|..|:|..:.:||:|
 Frog    59 LNVKNEELEEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGTGLLKSEYIREML 123

  Fly   130 TTMGDRFTDEDVDEMYRE-APIKNGLFDYLEFTRILKHGAKDKDE 173
            .|..:|||.|:||:|:.. .|...|..:|.....|:.|| ::|:|
 Frog   124 MTQAERFTSEEVDQMFTAFPPDVTGNLNYKNLVHIITHG-EEKEE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 83/156 (53%)
myl2NP_001107717.1 FRQ1 15..163 CDD:227455 79/148 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6423
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.