DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl7

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_012813980.1 Gene:myl7 / 100135145 XenbaseID:XB-GENE-964041 Length:173 Species:Xenopus tropicalis


Alignment Length:174 Identity:91/174 - (52%)
Similarity:116/174 - (66%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |:|||.||:.|.  |||||.:||||:||:|:||.||||||:.|||||||.:.|.||.:....|||
 Frog     1 MASRKAAGKAAA--KRAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIITKSDLKETYMQLGK 63

  Fly    66 -NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
             |..:|.||.|:.|..||||||:||:||||:|.||||||.|..||...|....|.:.:|.|::||
 Frog    64 MNVNEDELDEMLKEGKGPINFTVFLSLFGEKLNGTDPEDSILAAFKILDPNATGNINKDELKQLL 128

  Fly   130 TTMGDRFTDEDVDEMYREAPIK-NGLFDYLEFTRILKHGAKDKD 172
            .|..|:||.|:||:|:...||. .|..||.....|:.||.:.:|
 Frog   129 MTQADKFTAEEVDQMFAVTPIDVAGNIDYKSLCYIITHGDEKED 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 83/156 (53%)
myl7XP_012813980.1 PTZ00184 25..165 CDD:185504 72/139 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.