DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl9

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001096250.1 Gene:myl9 / 100124811 XenbaseID:XB-GENE-5949813 Length:172 Species:Xenopus tropicalis


Alignment Length:174 Identity:139/174 - (79%)
Similarity:158/174 - (90%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |||:||..:  |:|||.|||||||||||||:||.||||||||||||||||::||||||||||:||
 Frog     1 MSSKKTKAK--TSKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGK 63

  Fly    66 NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLT 130
            ||||:||:|||:|||||||||||||:|||:|.||||||||:|||.|||||..|.:.||.||||||
 Frog    64 NPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFINEDHLRELLT 128

  Fly   131 TMGDRFTDEDVDEMYREAPI-KNGLFDYLEFTRILKHGAKDKDE 173
            |||||||||:|||||||||| |.|.|:|:|||||||||||:||:
 Frog   129 TMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKEKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 129/155 (83%)
myl9NP_001096250.1 FRQ1 19..169 CDD:227455 124/149 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10073
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 286 1.000 Inparanoid score I2782
OMA 1 1.010 - - QHG51980
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 1 1.000 - - otm47478
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.