DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and UTR3

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_563949.1 Gene:UTR3 / 837998 AraportID:AT1G14360 Length:331 Species:Arabidopsis thaliana


Alignment Length:270 Identity:59/270 - (21%)
Similarity:102/270 - (37%) Gaps:67/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAGIILCTLV--SSGDVKDNTHHSL 154
            |..|..::.:|..::..|:||.::...||.|.:|....::..|:.:..|:  ||..:....|.:.
plant   106 ISYPAQVLAKSSKMIPVMLMGSLVYGIRYTLPEYLCTFLVAGGVSMFALLKTSSKTISKLAHPNA 170

  Fly   155 KVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPSEALFFTHMLPLPGFLIMAG- 218
                        .:|.||..:.|....:....|:.|..:|.|             ...:.||.| 
plant   171 ------------PLGYGLCFLNLAFDGFTNATQDSITARYPK-------------TNAWDIMLGM 210

  Fly   219 -------NIVQHFGIAWSSEPVAVPLLGAIGLE------------WKFPLMLFYLLCNVVTQYVC 264
                   |:|..||:...|           |.|            |.   :|.|.||..|.|   
plant   211 NLWGTIYNMVYMFGLPHGS-----------GFEAVQFCKQHPEAAWD---ILMYCLCGAVGQ--- 258

  Fly   265 ISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTILFANVINQVR 329
             :.:::..:...||..|.:.|.|||||::.|.:...||.:...| |.:.:.||.:.: .:..:.|
plant   259 -NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSSKQW-GCVSMVFGGLSY-QIYLKWR 320

  Fly   330 DAYRARSSRK 339
            ...|.:..:|
plant   321 KLQRMQKKKK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 56/254 (22%)
EamA 91..321 CDD:304911 56/250 (22%)
UTR3NP_563949.1 UAA 16..318 CDD:312076 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.