DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and AT1G12600

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_172720.1 Gene:AT1G12600 / 837816 AraportID:AT1G12600 Length:349 Species:Arabidopsis thaliana


Alignment Length:326 Identity:80/326 - (24%)
Similarity:146/326 - (44%) Gaps:62/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GMLFVFI--GCCSNVVFLELIIQIDPGAGNLITFAQ-FLFIALEGLVFTSKFFTVRPKIALKDYV 71
            |..|.::  |.|...|:..|....    |...|||| .::||   |::...|.|.:.....|.||
plant    32 GFFFGYLVNGICEEYVYNRLKFSY----GWYFTFAQGLVYIA---LIYMYGFRTKQMVNPWKTYV 89

  Fly    72 ILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVL--LKKRYNLRQYSSVAMITAG 134
            .|..:..|::.....:..: :..|..::|:|..::..|:||..:  |:::|.:.:|.|..::..|
plant    90 KLSGVLMGSHGLTKGSLAY-LNYPAQIMFKSTKVLPVMVMGAFIPGLRRKYPVHEYISAMLLVIG 153

  Fly   135 IILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPS 199
            :||.||   .|...:.:.|:             :|:.:::.||::.|::|..||.|:.   .:|.
plant   154 LILFTL---ADAHTSPNFSI-------------IGVMMISGALIMDAFLGNLQEAIFT---MNPE 199

  Fly   200 ----EALFFTHMLPLPGFL---IMAGNIVQHFGIAWSS---EPVAVPLLGAIGLEWKFPLMLFYL 254
                |.||.:.::.||..|   |:.|.:.    .||:|   .|            :.:.:::|..
plant   200 TTQMEMLFCSTVVGLPFLLAPMILTGELF----TAWNSCAQHP------------YVYGVLVFEA 248

  Fly   255 LCNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTI 319
            :...:.|...:|.:.:.    .:.|..::.|.||.|:||.|.:.|..|.|..|..|.:|:|.|.|
plant   249 MATFIGQVSVLSLIALF----GAATTAMITTARKAVTLLLSYLIFTKPLTEQHGTGLLLIFMGII 309

  Fly   320 L 320
            |
plant   310 L 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 80/326 (25%)
EamA 91..321 CDD:304911 59/242 (24%)
AT1G12600NP_172720.1 UAA 25..314 CDD:312076 80/326 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.