DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and AT5G59740

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_200782.1 Gene:AT5G59740 / 836095 AraportID:AT5G59740 Length:344 Species:Arabidopsis thaliana


Alignment Length:351 Identity:73/351 - (20%)
Similarity:143/351 - (40%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFVFIGCCSNVVFL----ELIIQIDPGAGNLITFAQFLFIALEGLVFTSKFFT------------ 60
            :|...|..|.:|..    |.|:::..|. |...|...||     |||.::..|            
plant    20 VFAVSGIMSTLVIYGVLQEKIMRVPYGV-NKEFFKHSLF-----LVFCNRLTTSAVSAGALLASK 78

  Fly    61 --VRPKIALKDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLR 123
              :.|...:..|.::.........|...|..: :..|:..:.:...::..|:.|.::::|:|...
plant    79 KVLDPVAPVYKYCLISVTNILTTTCQYEALKY-VSFPVQTLAKCAKMIPVMVWGTLIMQKKYKGF 142

  Fly   124 QYSSVAMITAGIILCTLVSSGD-------VKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTA 181
            .|....::|.|..:..|..:||       .::||             .|   |:.|:...|....
plant   143 DYLVAFLVTLGCSVFILFPAGDDVSPYNKGRENT-------------VW---GVSLMAGYLGFDG 191

  Fly   182 YMGIYQEVIYKKYGKHPSEALFFTHM----LPLPGFLIMAGNIVQHFGIAWSSEPVAVPLLGAIG 242
            :...:|:.::|.|.......:|:|.:    |...| ||:.|::              :|.:..:.
plant   192 FTSTFQDKLFKGYNMEIHNQIFYTTLCSCVLSFTG-LILQGHL--------------LPAVDFVS 241

  Fly   243 LEWKFPLMLFYLLCNVVT--QYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTL 305
            |. :..|:...||..|.|  |:. ||  |.:.| ..:||...::|.|:..|::.|.|:|.:|.:.
plant   242 LH-RDCLLDIALLSTVATASQFF-IS--YTIRT-FGALTFAAIMTTRQLASIMLSCIWFSHPLSW 301

  Fly   306 NHWVGTILVFFGTILFANVINQVRDA 331
            ...:|:::| ||::...|::|..:::
plant   302 EQCIGSVIV-FGSLYAKNLLNNKKNS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 72/343 (21%)
EamA 91..321 CDD:304911 52/242 (21%)
AT5G59740NP_200782.1 UAA 18..321 CDD:312076 72/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.