DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and znf618

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031747873.1 Gene:znf618 / 734035 XenbaseID:XB-GENE-6065985 Length:917 Species:Xenopus tropicalis


Alignment Length:98 Identity:24/98 - (24%)
Similarity:40/98 - (40%) Gaps:27/98 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RSGSLMANMIMG-IVLLKKRYNLRQYSSVAMITAGIILCTLVSSGDVKDN-THHSLKV--DTSYS 161
            |.||...|.|:| :..|..::..|.|:.|.:    .:.|.|.|:..:... |.||..|  |:.| 
 Frog   470 RYGSFSVNEILGNMNTLALKHLPRMYNQVKV----KVTCALGSNACLGIGVTCHSQSVGSDSCY- 529

  Fly   162 DFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKY 194
                            ::|||....:::  |:|
 Frog   530 ----------------ILTAYQVECKQI--KRY 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 24/98 (24%)
EamA 91..321 CDD:304911 24/98 (24%)
znf618XP_031747873.1 C2H2 Zn finger 101..121 CDD:275368
C2H2 Zn finger 142..162 CDD:275368
C2H2 Zn finger 198..218 CDD:275368
Dimer_Tnp_hAT 836..916 CDD:399013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.