DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and Papst2

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster


Alignment Length:343 Identity:84/343 - (24%)
Similarity:148/343 - (43%) Gaps:70/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FIGCCSNVVFL--------ELIIQID--PGAGNLITFAQFLFI--------ALEGL-VFTSKFFT 60
            |:..|:.|.||        |||..::  ...|..:|..||.:.        .|||. :....|:.
  Fly    62 FLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWN 126

  Fly    61 VRPK---IALKDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNL 122
            :.|:   |.::.|:||.||..|....:|.:..: :..|..:||:...|:..::..|::..|||.|
  Fly   127 IEPEPRCIPMRTYLILAALTLGTMGLSNSSLGY-LNYPTQVIFKCCKLIPVLVGSILIQGKRYGL 190

  Fly   123 RQYSSVAMITAGIILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQ 187
            ..:::...:..|:...||..|           ::..:::     .:|:.:::.|||..|.:|..|
  Fly   191 LDFAAATCMCIGLAWFTLADS-----------QMTPNFN-----LLGVAMISGALLCDAAIGNVQ 239

  Fly   188 EVIYKKYGKHPSEALFFTHMLPLPGF------LIMAGNIVQHFGIAWSSE-PVAVPLLGAIGLEW 245
            |...:::....||.:|:::.|   ||      :::.||...  |.|:..| ||.     ..|..:
  Fly   240 EKAMREFKAPSSEVVFYSYGL---GFVYLFVIMLVTGNFFS--GFAFCLEHPVE-----TFGYGF 294

  Fly   246 KFPLMLFYLLCNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNH-WV 309
            .|.|          :.|:.|..|..|.....:.....|.|.||.|::.||.:.|..||||.: |.
  Fly   295 LFSL----------SGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWS 349

  Fly   310 GTILVFFGTILFANVINQ 327
            |.|:|..   ::.||.::
  Fly   350 GLIVVLG---IYLNVYSK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 83/339 (24%)
EamA 91..321 CDD:304911 57/237 (24%)
Papst2NP_648954.1 UAA 61..364 CDD:285625 84/341 (25%)
EamA 219..362 CDD:279264 45/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.