DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and Slc35b3

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_225253.5 Gene:Slc35b3 / 306866 RGDID:1307183 Length:411 Species:Rattus norvegicus


Alignment Length:335 Identity:90/335 - (26%)
Similarity:150/335 - (44%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FIGCCSNV-VFL-------ELIIQID--PGAGNLITFAQFLFIALEGLVFTSKFFTVRPKIALKD 69
            |:.|.:.| ||.       |||..::  ...|..:|..||.|.::.||:........|.:|..|.
  Rat    91 FLICVAGVFVFYLIYGYLQELIFSMEGFKPYGWYLTLVQFAFYSVFGLIELQLTQDKRRRIPGKT 155

  Fly    70 YVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAG 134
            |:|:..|..|....:|.:..: :..|..:||:...|:..|:.|:.:..|||||...|:...::.|
  Rat   156 YMIIAFLTVGTMGLSNTSLGY-LNYPTQVIFKCCKLIPVMLGGVFIQGKRYNLADVSAAVCMSLG 219

  Fly   135 IILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPS 199
            :|..||               .|::.:..|..| |:.|:::||...|.:|..||...|.:....|
  Rat   220 LIWFTL---------------ADSTIAPNFNLT-GVMLISLALCADAVIGNVQEKAMKLHNASNS 268

  Fly   200 EALFFTHMLPLPGFLIMAGNIVQHFGIAWSSEPVAVPLLG-AIGLEWKFPLMLF-YLLCNVVTQY 262
            |.:.:::.:   ||:.:.      .|::.:|.      || |:....|.|:..: |.....:|.|
  Rat   269 EMVLYSYSI---GFVYIL------LGLSCTSG------LGPALAFCSKNPVRTYGYAFLFSLTGY 318

  Fly   263 VCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNH-WVGTILVFFGTILFANVIN 326
            ..||.|..|.....:|....|.|.||.::::.|.::|..|||..: |.| :||..|  :|.||.:
  Rat   319 FGISFVLALIKIFGALLAVTVTTGRKAMTIVLSFLFFAKPFTFQYIWSG-LLVVLG--IFLNVYS 380

  Fly   327 QVRDAYRARS 336
            :..|..|..|
  Rat   381 KNMDKIRLPS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 86/322 (27%)
EamA 91..321 CDD:304911 61/232 (26%)
Slc35b3XP_225253.5 UAA 90..381 CDD:285625 87/324 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.