DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and S35B3_ANOGA

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_316536.4 Gene:S35B3_ANOGA / 1277103 VectorBaseID:AGAP006509 Length:377 Species:Anopheles gambiae


Alignment Length:357 Identity:85/357 - (23%)
Similarity:157/357 - (43%) Gaps:69/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FIGCCSNVVFL--------ELIIQID---PGAGNLITFAQFLFIALEGLVFTSKFFTVRPK-IAL 67
            |:.||..|..|        |||..::   | .|..:|..||.:....|.:..|...|..|: |.|
Mosquito    48 FLLCCGGVFALYLVYGYMQELIFTLEGFRP-YGWYLTLVQFAYYTAFGYIERSVERTTVPRCIPL 111

  Fly    68 KDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMIT 132
            :.|.:|..|..|....:|.:..: :..|..:||:...|:..:|..:::..|::....:.:...:.
Mosquito   112 RTYALLAFLTLGTMGLSNSSVGY-LNYPTQVIFKCCKLIPVLIGSVLIQGKKHGPMDFFAATAMC 175

  Fly   133 AGIILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKH 197
            .|:||.||..|           :|...::.|     |:.|:::|||..|.:|..||...:::...
Mosquito   176 LGLILFTLADS-----------QVQPDFNRF-----GVFLISLALLCDAAIGNVQEKAMREHRAP 224

  Fly   198 PSEALFFTHMLPLPGF------LIMAGNIVQHFGIAWSSEPVAVPLLGAIGLEWKFPLMLF-YLL 255
            .:|.:.:::.:   ||      ::::|::||  |:|:.:               ::|:..: |..
Mosquito   225 NNEVVIYSYGI---GFVYLAVIMLLSGHLVQ--GVAFCA---------------RYPMETYGYAF 269

  Fly   256 CNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNH-WVGTILVFFGTI 319
            ...:|.|:.|..|..|...|.:.....|.|.||.|::..|.::|..|||:.: |.|.|:||.   
Mosquito   270 LFSLTGYLGIQIVLTLVRTCGAPLAATVTTARKAVTIALSFVFFSKPFTIQYLWSGLIVVFG--- 331

  Fly   320 LFANVINQVRDAYRARSSRKTHFDTAPLAKKV 351
            ::.||.        ::.|:.|..|...:|..|
Mosquito   332 IYLNVY--------SKRSKLTFADLGRMASTV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 79/329 (24%)
EamA 91..321 CDD:304911 54/237 (23%)
S35B3_ANOGAXP_316536.4 UAA 47..339 CDD:285625 80/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.