DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efr and AgaP_AGAP002571

DIOPT Version :9

Sequence 1:NP_572299.1 Gene:Efr / 31553 FlyBaseID:FBgn0029849 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_312365.4 Gene:AgaP_AGAP002571 / 1273395 VectorBaseID:AGAP002571 Length:478 Species:Anopheles gambiae


Alignment Length:316 Identity:64/316 - (20%)
Similarity:131/316 - (41%) Gaps:67/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AQFLFIA--LEGLVFTSKFFTVRPKIALKDYVILVALFFGANVCNNY----AFNFNIPMPLHMIF 100
            :|||..:  :.|.:.|:.:...:.:...:..:...:....:|:.:.:    |..| :..|..::.
Mosquito   191 SQFLVFSNRVLGFLITAVYLVAKRQFRHRAPLYKYSFASFSNIMSAWFQYEALKF-VNFPTQVLA 254

  Fly   101 RSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAGIILCTLVSSGDVKDNTHHSLKVDTSYSDFFW 165
            :|..::..||||.::.:.:|...:|.:..||:.|:|.....|:.:.|.:...:|           
Mosquito   255 KSCKIIPVMIMGKIISRNKYEFYEYLTAVMISVGMIFFLTGSTDESKASAMTTL----------- 308

  Fly   166 WTVGIGLLTIALLVTAYMGIYQEVIYKKY---------GKHPSEALFFTHMLPLPG----FLIMA 217
              .|:.|||..::..::...:|..::|.|         |.:....||....|.:.|    .|:.|
Mosquito   309 --TGVLLLTFYMIFDSFTSNWQGELFKSYSMSSIQMMCGVNLFSTLFTGASLAMQGGFYSSLVFA 371

  Fly   218 GNIVQH--FGIAWSSEPVAVPLLGAIGLEWKFPLMLFYLLCNVVTQYVCISAVYVLTTECASLTV 280
               |.|  |.:    :.|.:.:..|||     .|.:||.:...                 .::..
Mosquito   372 ---VDHPKFVV----DCVVLSISSAIG-----QLFIFYTIATF-----------------GAVVF 407

  Fly   281 TLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTILFANV-INQVRDAYRAR 335
            |:::|||:.|::|.|.:.:::..:....||.::||..  :|..| .||...|.:.|
Mosquito   408 TIIMTLRQAVAILLSCLIYQHRISFLGVVGVLIVFLA--IFLRVYCNQRLKAIKQR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EfrNP_572299.1 UAA 6..325 CDD:285625 60/304 (20%)
EamA 91..321 CDD:304911 50/244 (20%)
AgaP_AGAP002571XP_312365.4 UAA 155..450 CDD:285625 59/303 (19%)
EamA <386..447 CDD:279264 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.