powered by:
Protein Alignment Btnd and YIL165C
DIOPT Version :9
Sequence 1: | NP_572298.1 |
Gene: | Btnd / 31552 |
FlyBaseID: | FBgn0029848 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012101.1 |
Gene: | YIL165C / 854641 |
SGDID: | S000001427 |
Length: | 119 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 23/53 - (43%) |
Gaps: | 9/53 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 GWAFGNDVNVLAADA--SNPDGRTSGSGIYAGRGGRLVAEIFEQPTTKLLIAE 292
||...:| |.:...: .:|.|... :|...|:.|.|.|||... ||||
Yeast 42 GWPSADD-NCINGGSVIIDPYGEII-AGPLLGQEGLLTAEINTD-----LIAE 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0388 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.