DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and NTA1

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_012596.3 Gene:NTA1 / 853525 SGDID:S000003823 Length:457 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:36/142 - (25%)
Similarity:55/142 - (38%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VVEHSQPVG--DSPRARTTSASESFQKIIREVGDVDIIVFPEHILNSQATATFVPHESQNITPCY 95
            |::.:..:|  |....||.|..:...|....| ..|||:|||..|...:.     |..::|.|..
Yeast    23 VIQLNPQIGQVDQTIKRTWSILDKVTKSATYV-KPDIILFPEFALTGYSF-----HARKDILPYV 81

  Fly    96 QTDYELFLIELSCSARANHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIV 160
            ....|....||:.|           :.||..|....|    .|......:.:|:.:|.:.:|..:
Yeast    82 TKKDEGPSFELAKS-----------ISEKFQCYTIIG----YPEDDDEQKLYNSALVVNPQGEQI 131

  Fly   161 SRYRKTHLWRHE 172
            ..||||.|:..|
Yeast   132 FNYRKTFLYDTE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 36/142 (25%)
NTA1NP_012596.3 ScNTA1_like 20..315 CDD:143590 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.