DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and BETA-UP

DIOPT Version :10

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_201242.2 Gene:BETA-UP / 836558 AraportID:AT5G64370 Length:408 Species:Arabidopsis thaliana


Alignment Length:201 Identity:40/201 - (19%)
Similarity:71/201 - (35%) Gaps:67/201 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FLIELSCSARANHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKT 166
            ||.||   |:..::.:|..::|:::              ..|...:||.|:....|.|:.::||.
plant   166 FLQEL---AKKYNMVIVSPILERDI--------------DHGEVLWNTAVIIGNNGNIIGKHRKN 213

  Fly   167 HLWR-HEYVSTSVLRSPDIS--IFRTDFGVTFGHFICFDMLFYDPAMKLVKEHKITDIVYPTYWF 228
            |:.| .::..::.....|..  :|.|.|| .....||:.            .|      :|..|.
plant   214 HIPRVGDFNESTYYMEGDTGHPVFETVFG-KIAVNICYG------------RH------HPLNWL 259

  Fly   229 SELPFLGAVQLQEGWAFG-NDVNVL------AADASNP----DGRTS--GSGIYAGRGGRLVAEI 280
                           ||| |...::      ..:.|.|    :.|.:  .:..:.|...|:..|:
plant   260 ---------------AFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEV 309

  Fly   281 FEQPTT 286
            |..|.|
plant   310 FPNPFT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 40/201 (20%)
Vanin_C 325..511 CDD:465946
BETA-UPNP_201242.2 PLN00202 4..408 CDD:177792 40/201 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.