DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and nit1

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001004638.1 Gene:nit1 / 447900 ZFINID:ZDB-GENE-040912-65 Length:316 Species:Danio rerio


Alignment Length:232 Identity:51/232 - (21%)
Similarity:90/232 - (38%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFLLLSVLFSSSHQLSKPEDPTYTAAVVEHSQPVGDSPRARTTSASESFQKIIRE--VGDVDIIV 69
            |...:.:|..:|...|:.......|||.:.:.........||.:      :::.:  ||...::.
Zfish    12 SAFTVGLLAWASRGQSRMSSSVPVAAVCQMTATPDKEANFRTCT------RLVEQAKVGGASMVF 70

  Fly    70 FPE--HILNSQATATFVPHESQNITPCYQTDYELFLIELSCSARANHLYVVINVVEKELCAHGAG 132
            .||  ..:.|....|....||               ::....:|..||...::|.......|..|
Zfish    71 LPEGFDYIGSSREETLQLSES---------------LDGETISRYTHLARKLDVWLSLGGFHEQG 120

  Fly   133 SDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKTHLWRHEYVSTSV-LRSPDISI--------FR 188
            .|.     .:..|.:|::::.:.:|.|||.||||||:..|..|..| |:....:|        .:
Zfish   121 HDW-----KTDRRIYNSHIIINGQGEIVSVYRKTHLFDVELSSKGVSLKESAFTIPGPRLVPPVQ 180

  Fly   189 TDFGVTFGHFICFDMLFYDPAMKLVKEHKITDIVYPT 225
            |..| ..|..:|:|:.|.:.:..| :.|....:.||:
Zfish   181 TPIG-KVGLGVCYDLRFPELSAAL-QRHGAEILTYPS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 47/210 (22%)
nit1NP_001004638.1 nit 36..304 CDD:143596 47/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.