DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and pyd3

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_649732.1 Gene:pyd3 / 40916 FlyBaseID:FBgn0037513 Length:386 Species:Drosophila melanogaster


Alignment Length:377 Identity:76/377 - (20%)
Similarity:131/377 - (34%) Gaps:123/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EDPTYTAAVVEHSQPVGDSPRARTTSASESFQK--IIREVGDV-DIIVFP---------EHILNS 77
            |.||....:.|  |...|....|.|:..|..:|  |:| ||.: :.||.|         |.|.|.
  Fly    39 ELPTSAKDIAE--QNGFDIKGYRFTAREEQTRKRRIVR-VGAIQNSIVIPTTAPIEKQREAIWNK 100

  Fly    78 QATATFVPHESQNITPCYQTDYEL--------------------------FLIELSCSARANHLY 116
            ..|......|:.....|.|..:.:                          .|.||   |:|.::.
  Fly   101 VKTMIKAAAEAGCNIVCTQEAWTMPFAFCTREKFPWCEFAEEAENGPTTKMLAEL---AKAYNMV 162

  Fly   117 VVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKTHLWR------HEYVS 175
            ::.:::|:::              ..|...:||.||....||.:.::||.|:.|      ..|..
  Fly   163 IIHSILERDM--------------EHGETIWNTAVVISNSGRYLGKHRKNHIPRVGDFNESTYYM 213

  Fly   176 TSVLRSPDISIFRTDFG-----VTFG-----HFICFDM----LFYDPAMKLVK-EHKITDI---- 221
            ......|   :|.|:||     :.:|     :::.|.:    :.::|:..:.: ...:..|    
  Fly   214 EGNTGHP---VFETEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSATIGRLSEPLWSIEARN 275

  Fly   222 --VYPTYWFSELPFLGAVQLQEGWAFGNDVNVL---------AADASNPDGRTSGSGIYAGRGGR 275
              :..:|:...:..:|..|....:..| |.|..         ::..:.|||..:.| :...:.|.
  Fly   276 AAIANSYFTVPINRVGTEQFPNEYTSG-DGNKAHKEFGPFYGSSYVAAPDGSRTPS-LSRDKDGL 338

  Fly   276 LVAEI-------------FEQPTTKLLIAEVPKR--EHGQLAPTFTPIFEPQ 312
            ||.|:             |.......|.||..|:  |||         |:||
  Fly   339 LVVELDLNLCRQVKDFWGFRMTQRVPLYAESFKKASEHG---------FKPQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 70/367 (19%)
pyd3NP_649732.1 PLN00202 9..385 CDD:177792 76/377 (20%)
ML_beta-AS 9..372 CDD:143611 69/357 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.