DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and nit2

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_991174.3 Gene:nit2 / 402904 ZFINID:ZDB-GENE-050522-65 Length:284 Species:Danio rerio


Alignment Length:280 Identity:64/280 - (22%)
Similarity:104/280 - (37%) Gaps:90/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QKIIREVG--DVDIIVFPEHILNSQATATF------VPHESQNITPCYQTDYELFLIELSCSARA 112
            |.::.|..  ...::|.||...:...|..|      :|.||..:              ||.:|:.
Zfish    32 QTLVTEAAGQGAKVVVLPECFNSPYGTGFFKEYAEKIPGESTQV--------------LSETAKK 82

  Fly   113 NHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKTHLW------RH 171
            ..:|:|...:.:|                .|.:.:||..||...|:::..:||.||:      :.
Zfish    83 CGIYLVGGSIPEE----------------DGGKLYNTCSVFGPDGKLLVTHRKIHLFDIDVPGKI 131

  Fly   172 EYVSTSVLRSP--DISIFRTDFGVTFGHFICFDMLFYDPAMKLVKEHKITDIVY---------PT 225
            .:..:..| ||  .:|:|.|.: ...|..||:|:.|.:.|....|: ....:||         |.
Zfish   132 RFQESETL-SPGKSLSMFETPY-CKVGVGICYDIRFAELAQIYAKK-GCQLLVYPGAFNMTTGPA 193

  Fly   226 YWFSELPFLGAVQLQEGWAFGNDVNVLAADAS----------------NPDGR------TSGSGI 268
            :|  ||       ||.|.|..|.|.|..|..:                ||.|.      :..|.:
Zfish   194 HW--EL-------LQRGRAVDNQVYVATASPARDETASYVAWGHSSVINPWGEVISKAGSEESVV 249

  Fly   269 YAGRGGRLVAEIFEQ-PTTK 287
            ||....:.:|::.:| |.||
Zfish   250 YADIDLQYLADVRQQIPITK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 64/280 (23%)
nit2NP_991174.3 nit 12..272 CDD:143596 64/280 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.