DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and Nit2

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_038944121.1 Gene:Nit2 / 288174 RGDID:1310494 Length:360 Species:Rattus norvegicus


Alignment Length:280 Identity:64/280 - (22%)
Similarity:109/280 - (38%) Gaps:65/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IIREVG--DVDIIVFPEHILNSQATATFVPHESQNITPCYQTDYELFLIELSCSARANHLYVVIN 120
            ::||..  ..:|:..|| ..||.....:.|..::.| |...|.      :||..|:.|.:|::..
  Rat   111 LVREAAKQGANIVSLPE-CFNSPYGTNYFPEYAEKI-PGESTK------KLSEVAKENSIYLIGG 167

  Fly   121 VVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKTHLW------RHEYVSTSVL 179
            .:.:|               ..| :.:||..||...|.::.::||.||:      :..:..:..|
  Rat   168 SIPEE---------------DDG-KLYNTCAVFGPDGNLLVKHRKIHLFDIDVPGKITFQESKTL 216

  Fly   180 RSPD-ISIFRTDFGVTFGHFICFDMLFYDPAMKLVKEHKITDIVY---------PTYWFSELPFL 234
            ...| .|.|.|.: ...|..||:||.|.:.| ::........:||         |.:|  ||   
  Rat   217 SPGDSFSTFDTPY-CRVGLGICYDMRFAELA-QIYARRGCQLLVYPGAFNMTTGPAHW--EL--- 274

  Fly   235 GAVQLQEGWAFGNDVNVLAADASNPDGRTSGSGIYAGRGGRLVAEIFEQPTTK------LLIAEV 293
                ||...|..|.|.|..|..:. |.:.|    |...|...|.:.:.|..||      :|.:::
  Rat   275 ----LQRARAVDNQVYVATASPAR-DEKAS----YVAWGHSTVVDPWGQVLTKAGTEETILYSDI 330

  Fly   294 PKREHGQLAPTFTPIFEPQR 313
            ..::..::.... ||.:.:|
  Rat   331 DLKKLSEIRQQI-PILKQKR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 61/273 (22%)
Nit2XP_038944121.1 nit 89..349 CDD:143596 63/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.