DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and Nit1

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_036179.1 Gene:Nit1 / 27045 MGIID:1350916 Length:323 Species:Mus musculus


Alignment Length:326 Identity:70/326 - (21%)
Similarity:116/326 - (35%) Gaps:99/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PRARTTSASESFQKIIREVGDVDIIVFPEHILNSQATATFVPHESQNITPCYQTDYELFLIELSC 108
            ||.||.|:|.|::..:..|              .|.|:|  |::.:|...|.:...|...:. :|
Mouse    29 PRPRTMSSSTSWELPLVAV--------------CQVTST--PNKQENFKTCAELVQEAARLG-AC 76

  Fly   109 SARANHL--YVVINVVEKELCA---------------------------HGAGSDTYNPCPSSGV 144
            .|.....  ::..|..|..|.:                           |..|.|.     ....
Mouse    77 LAFLPEAFDFIARNPAETLLLSEPLNGDLLGQYSQLARECGIWLSLGGFHERGQDW-----EQNQ 136

  Fly   145 RYFNTNVVFDRRGRIVSRYRKTHLWRHEYVSTSVLR-----------SPDISIFRTDFGVTFGHF 198
            :.:|.:|:.:.:|.:|:.||||||...|......:|           .|.:   :|..| ..|..
Mouse   137 KIYNCHVLLNSKGSVVASYRKTHLCDVEIPGQGPMRESNYTKPGGTLEPPV---KTPAG-KVGLA 197

  Fly   199 ICFDMLFYDPAMKLVKEHKITDIVYPTYWFSELPFLGAVQLQEGW-------AFGNDVNVLAAD- 255
            ||:||.|.:.::||. :.....:.||:.:       |:|.....|       |..:...|:||. 
Mouse   198 ICYDMRFPELSLKLA-QAGAEILTYPSAF-------GSVTGPAHWEVLLRARAIESQCYVIAAAQ 254

  Fly   256 -ASNPDGRTS-GSGIYAGRGGRLVAEIFEQPTTKLLIAEV------PKREHGQLAPTFTPIFEPQ 312
             ..:.:.|.| |..:.....|.:||...|.|  .|.:|.:      ..|:|       .|:|:.:
Mouse   255 CGRHHETRASYGHSMVVDPWGTVVARCSEGP--GLCLARIDLHFLQQMRQH-------LPVFQHR 310

  Fly   313 R 313
            |
Mouse   311 R 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 67/319 (21%)
Nit1NP_036179.1 nit 44..311 CDD:143596 62/309 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.