DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and nit-1

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_497791.1 Gene:nit-1 / 191515 WormBaseID:WBGene00014206 Length:305 Species:Caenorhabditis elegans


Alignment Length:221 Identity:47/221 - (21%)
Similarity:86/221 - (38%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AVVEHSQPVGDSPRARTTSASESFQKIIREV--GDVDIIVFPEHILNSQ--------ATATFVPH 86
            |:|:...|:.|.|     :..|..:|.:.|.  ...::::|||..:...        ...|..|.
 Worm     5 AIVQAGTPLFDKP-----ATLEKVKKNVEEAAGNGAELVLFPEAFIGGYPKWNSFGITMGTRTPE 64

  Fly    87 ESQNITPCY-----QTDYELFLIELSCSARANHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRY 146
            ..:.....:     :...|..||| |.:|: |::::||.|||:|      .|..|  |   .|.:
 Worm    65 GRKEFKRYFENAIEENGEESKLIE-SLAAQ-NNIHIVIGVVERE------ASTLY--C---SVFF 116

  Fly   147 FNTNVVFDRRGRIVSRYRKTHLWRHEYVSTSVLRSPDISIFRTDFGVTFGHFICFDMLFYDPAMK 211
            ::.:....:..:::....:..:|.....||       :.:|.|..| ..|..||::.  |.|..:
 Worm   117 YSPSGYLGKHRKLLPTALERCVWGQGDGST-------MPVFSTSVG-KIGSAICWEN--YMPLYR 171

  Fly   212 LVKEHKITDI-VYPT-----YWFSEL 231
            :....|...| :.||     .|.|.:
 Worm   172 MTLYSKEIQIYLAPTVDDRDVWLSTM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 47/221 (21%)
nit-1NP_497791.1 nitrilases_CHs 3..296 CDD:143588 47/221 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.