DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btnd and nft-1

DIOPT Version :9

Sequence 1:NP_572298.1 Gene:Btnd / 31552 FlyBaseID:FBgn0029848 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_499556.1 Gene:nft-1 / 176628 WormBaseID:WBGene00003594 Length:440 Species:Caenorhabditis elegans


Alignment Length:340 Identity:69/340 - (20%)
Similarity:117/340 - (34%) Gaps:101/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RTTSASESFQKIIREVGDVDI---------IVFPEHILNSQATATFVP--------HESQNITPC 94
            ||.:....|..:.:...|.|:         ::  |.....:....|:|        ::::.|...
 Worm     8 RTMATGRHFIAVCQMTSDNDLEKNFQAAKNMI--ERAGEKKCEMVFLPECFDFIGLNKNEQIDLA 70

  Fly    95 YQTDYELFLIELSCSARANHLYVVINVVEKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRI 159
            ..||.| ::.:....||.:::::.:..:.     |...||..:|        :||:::.|..|..
 Worm    71 MATDCE-YMEKYRELARKHNIWLSLGGLH-----HKDPSDAAHP--------WNTHLIIDSDGVT 121

  Fly   160 VSRYRKTHLWRHEY-------------VSTSVLRSPDISIFRTDFGVTFGHFICFDMLFYDPAMK 211
            .:.|.|.||:..|.             ..|.::...|..|.|      .|..||:|:.|  |.:.
 Worm   122 RAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGR------LGLSICYDVRF--PELS 178

  Fly   212 LVKEHKITDIVYPTYWFSELPFLGAVQLQEG---W-------AFGNDVNVLAA---DASNPDGRT 263
            |....:...:         |.|..|..|..|   |       |..|...|:||   .|.||..::
 Worm   179 LWNRKRGAQL---------LSFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQS 234

  Fly   264 SGSGIYAGRGGRLVAEIFEQPTTKLLIAEV------PKREHGQLAPTFTPIFEPQR--------- 313
            .|..:.....|.:||:..|:  ..:..||:      ..||       ..|:|..:|         
 Worm   235 YGHSMVVDPWGAVVAQCSER--VDMCFAEIDLSYVDTLRE-------MQPVFSHRRSDLYTLHIN 290

  Fly   314 -KTQRLTGLATYRDN 327
             |:....||...|.|
 Worm   291 EKSSETGGLKFARFN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtndNP_572298.1 biotinidase_like 29..308 CDD:143591 61/309 (20%)
nft-1NP_499556.1 nit 17..281 CDD:143596 60/305 (20%)
FHIT 300..418 CDD:238606 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.