DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and YIL165C

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_012101.1 Gene:YIL165C / 854641 SGDID:S000001427 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:23/100 - (23%)
Similarity:38/100 - (38%) Gaps:24/100 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGE-----AKNSTFL 184
            |:...|.|:|....|.....|.:.|      :|:.|..|.:::.    .|.|:     |:.:|.|
Yeast    30 IIDQATGKRKLPGWPSADDNCINGG------SVIIDPYGEIIAG----PLLGQEGLLTAEINTDL 84

  Fly   185 PELITFETDFGVTFGHFICFDILFYTPAHQLIVEQ 219
            .....|:.|   ..||:...|:.      ||.|.:
Yeast    85 IAEARFDLD---PVGHYARGDVF------QLTVNE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 23/99 (23%)
YIL165CNP_012101.1 nitrilase <1..110 CDD:416265 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.