DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and NTA1

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_012596.3 Gene:NTA1 / 853525 SGDID:S000003823 Length:457 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:67/312 - (21%)
Similarity:110/312 - (35%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSVVLLILGLMPGMSQQAALAESDYYTAGVVEFKQSILSLSAWSDSLAGYVEIINSENASAT--- 69
            :|:.:|::.|.|.:.|                ..|:|  ...||        |::....|||   
Yeast    17 VSLKVLVIQLNPQIGQ----------------VDQTI--KRTWS--------ILDKVTKSATYVK 55

  Fly    70 -DIIVFPESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKYIVINLTEKQ 133
             |||:|||..|     |.:..:....|.|.::..:               ...|..:..:::||.
Yeast    56 PDIILFPEFAL-----TGYSFHARKDILPYVTKKD---------------EGPSFELAKSISEKF 100

  Fly   134 KCEDI---PEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEAKN--STFLPE-LITFET 192
            :|..|   |||     .:...::|:.:|.:.||..:..|||..||....|  ....|| ..||..
Yeast   101 QCYTIIGYPED-----DDEQKLYNSALVVNPQGEQIFNYRKTFLYDTEMNWDCEENPEGFQTFPM 160

  Fly   193 DFG------------------VTFGHFICFDI---LFYTPAH-----QLIVEQGITDFVYPAMWF 231
            ||.                  .:.|  ||.|:   .|..|.:     ...|:..:...:.|..|.
Yeast   161 DFSKCAKLSNEDSYNRDVTLKASIG--ICMDLSPYKFMAPFNHFEFSSFCVDNNVELILCPMAWL 223

  Fly   232 SQLPFLTAVQTQQGWAYANDV-----NLLASGASRPSIGNSGS-GIYHGRSG 277
            :.    |:: |.:...:.|.:     |.:|.......:..:|| |||..:.|
Yeast   224 NS----TSI-TDKQTLHNNSLLEAAKNKIAFALKEQGLPLAGSQGIYQLKIG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 62/287 (22%)
NTA1NP_012596.3 ScNTA1_like 20..315 CDD:143590 66/309 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.