DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and Nit2

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_075664.1 Gene:Nit2 / 52633 MGIID:1261838 Length:276 Species:Mus musculus


Alignment Length:297 Identity:68/297 - (22%)
Similarity:117/297 - (39%) Gaps:72/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FKQSILSL---SAWSDSLAGYVEIINSENASATDIIVFPESTLNSAGSTTFVPNPEDQINPCLSD 101
            |:.:::.|   |..||:|.....::........:|:..|| ..||...||:.|:..::|      
Mouse     4 FRLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPE-CFNSPYGTTYFPDYAEKI------ 61

  Fly   102 PNATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVV 166
            |.     |....||..|:.:|.|::..        .|||:      :...::||..||...|.::
Mouse    62 PG-----ESTQKLSEVAKESSIYLIGG--------SIPEE------DAGKLYNTCSVFGPDGSLL 107

  Fly   167 SRYRKVHLYG----------EAKNSTFLPELITFETDFGVTFGHFICFDILFYTPAHQLIVEQGI 221
            .::||:||:.          |:|..:......||:|.: ...|..||:|:.|...| |:..::|.
Mouse   108 VKHRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPY-CKVGLGICYDMRFAELA-QIYAQRGC 170

  Fly   222 TDFVY---------PAMWFSQLPFLTAVQTQQGWAYANDVNLLASGASRPSIGNSGSGIYHGRSG 277
            ...||         ||.|  :|       .|:..|..|.|.:   ..:.|:..:..|.:..|.|.
Mouse   171 QLLVYPGAFNLTTGPAHW--EL-------LQRARAVDNQVYV---ATASPARDDKASYVAWGHST 223

  Fly   278 TLT---SVMRQDSGERAIYVAQVPKYTRSRSLKKRAK 311
            .:.   .|:.:...|..|..:.:       .|||.|:
Mouse   224 VVDPWGQVLTKAGTEETILYSDI-------DLKKLAE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 64/288 (22%)
Nit2NP_075664.1 nit 5..265 CDD:143596 67/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.