DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and UPB1

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_011528524.1 Gene:UPB1 / 51733 HGNCID:16297 Length:411 Species:Homo sapiens


Alignment Length:279 Identity:61/279 - (21%)
Similarity:101/279 - (36%) Gaps:66/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNG 149
            |.|..:.||       .|...:.::.       |:|....:|..:.|:.            :.:|
Human   163 TEFAESAED-------GPTTRFCQKL-------AKNHDMVVVSPILERD------------SEHG 201

  Fly   150 LNVFNTNVVFDRQGVVVSRYRKVHL--YGEAKNSTFLPE----LITFETDFG-----VTFGHFIC 203
            ..::||.||....|.|:.:.||.|:  .|:...||:..|    ...|:|.||     :.:|....
Human   202 DVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHP 266

  Fly   204 FDILFYT-PAHQLIVEQGIT-DFVYPAMW--------FSQLPFLTAVQTQQGWAYANDVNLLASG 258
            .:.|.|: ...::|.....| ..:..::|        .:...|..|:.......:.|:   ..||
Human   267 LNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNE---FTSG 328

  Fly   259 ASRPSIGNSGSGIYHGRSGTLTSVMRQDSGERAIYVAQVPKYTRSRSLKKRAKRSLQEIQTRQVA 323
            ..:.:  :...|.::|.|    .|...||       ::.|..:|||.....||..|...|  ||.
Human   329 DGKKA--HQDFGYFYGSS----YVAAPDS-------SRTPGLSRSRDGLLVAKLDLNLCQ--QVN 378

  Fly   324 SSSSFYMKRDYVENYESEL 342
            ...:|.|...| |.|..||
Human   379 DVWNFKMTGRY-EMYAREL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 46/239 (19%)
UPB1XP_011528524.1 PLN00202 6..411 CDD:177792 61/279 (22%)
ML_beta-AS 9..398 CDD:143611 61/279 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.