DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and NIT1

DIOPT Version :10

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_005245271.1 Gene:NIT1 / 4817 HGNCID:7828 Length:344 Species:Homo sapiens


Alignment Length:92 Identity:27/92 - (29%)
Similarity:43/92 - (46%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VFNTNVVFDRQGVVVSRYRKVHLY-----GEA----KNSTFL-PELITFETDFGVTFGHFICFDI 206
            ::|.:|:.:.:|.||:.|||.||.     |:.    .|||.. |.|.:..:......|..:|:|:
Human   159 IYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDM 223

  Fly   207 LFYTPAHQLIVEQ-GITDFVYPAMWFS 232
            .|  |...|.:.| |.....||:.:.|
Human   224 RF--PELSLALAQAGAEILTYPSAFGS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 27/92 (29%)
Vanin_C 328..512 CDD:465946
NIT1XP_005245271.1 nit 65..332 CDD:143596 27/92 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.