DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and NIT1

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_005245271.1 Gene:NIT1 / 4817 HGNCID:7828 Length:344 Species:Homo sapiens


Alignment Length:92 Identity:27/92 - (29%)
Similarity:43/92 - (46%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VFNTNVVFDRQGVVVSRYRKVHLY-----GEA----KNSTFL-PELITFETDFGVTFGHFICFDI 206
            ::|.:|:.:.:|.||:.|||.||.     |:.    .|||.. |.|.:..:......|..:|:|:
Human   159 IYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDM 223

  Fly   207 LFYTPAHQLIVEQ-GITDFVYPAMWFS 232
            .|  |...|.:.| |.....||:.:.|
Human   224 RF--PELSLALAQAGAEILTYPSAFGS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 27/92 (29%)
NIT1XP_005245271.1 nit 65..332 CDD:143596 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.