DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and nit2

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_991174.3 Gene:nit2 / 402904 ZFINID:ZDB-GENE-050522-65 Length:284 Species:Danio rerio


Alignment Length:332 Identity:72/332 - (21%)
Similarity:124/332 - (37%) Gaps:100/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AGVV----EFKQSILSL---SAWSDSLAGYVEIINSENASATDIIVFPESTLNSAGSTTFVPNPE 92
            :|:|    :|:.:::.|   ...:|:|.....::.........::|.||                
Zfish     2 SGIVKAMSKFRLAVVQLHVSKIKADNLGRAQTLVTEAAGQGAKVVVLPE---------------- 50

  Fly    93 DQINPCLSDPNAT-YYEEF--------LVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASN 148
                 |.:.|..| :::|:        ...||..|:....|:|..        .|||:      :
Zfish    51 -----CFNSPYGTGFFKEYAEKIPGESTQVLSETAKKCGIYLVGG--------SIPEE------D 96

  Fly   149 GLNVFNTNVVFDRQGVVVSRYRKVHLY-----GEAK---NSTFLP--ELITFETDFGVTFGHFIC 203
            |..::||..||...|.::..:||:||:     |:.:   :.|..|  .|..|||.: ...|..||
Zfish    97 GGKLYNTCSVFGPDGKLLVTHRKIHLFDIDVPGKIRFQESETLSPGKSLSMFETPY-CKVGVGIC 160

  Fly   204 FDILFYTPAHQLIVEQGITDFVY---------PAMWFSQLPFLTAVQTQQGWAYANDVNLLASGA 259
            :||.|...| |:..::|....||         ||.|  :|       .|:|.|..|.|.:   ..
Zfish   161 YDIRFAELA-QIYAKKGCQLLVYPGAFNMTTGPAHW--EL-------LQRGRAVDNQVYV---AT 212

  Fly   260 SRPSIGNSGSGIYHGRSGTLTS----VMRQDSGERAIYV-----------AQVPKYTRSRSLKKR 309
            :.|:...:.|.:..|.|..:..    :.:..|.|..:|.           .|:| .|:.|.....
Zfish   213 ASPARDETASYVAWGHSSVINPWGEVISKAGSEESVVYADIDLQYLADVRQQIP-ITKQRRNDLY 276

  Fly   310 AKRSLQE 316
            :..|:||
Zfish   277 SVNSVQE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 68/318 (21%)
nit2NP_991174.3 nit 12..272 CDD:143596 65/309 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.