DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and Nit2

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_038944121.1 Gene:Nit2 / 288174 RGDID:1310494 Length:360 Species:Rattus norvegicus


Alignment Length:344 Identity:72/344 - (20%)
Similarity:132/344 - (38%) Gaps:88/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LILGLMPGMSQQAALAESDYYTAGVVEFKQSILSL---SAWSDSLAGYVEIINSENASATDIIVF 74
            |:.|..||....:        .:||:.|:.:::.|   |..||::.....::........:|:..
  Rat    69 LVSGSWPGCPAPS--------RSGVLAFRLALIQLQVSSIKSDNITRACSLVREAAKQGANIVSL 125

  Fly    75 PESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIP 139
            || ..||...|.:.|...::|      |.     |....||..|:..|.|::..        .||
  Rat   126 PE-CFNSPYGTNYFPEYAEKI------PG-----ESTKKLSEVAKENSIYLIGG--------SIP 170

  Fly   140 EDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYG----------EAKNSTFLPELITFETDF 194
            |:     .:| .::||..||...|.::.::||:||:.          |:|..:......||:|.:
  Rat   171 EE-----DDG-KLYNTCAVFGPDGNLLVKHRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPY 229

  Fly   195 GVTFGHFICFDILFYTPAHQLIVEQGITDFVY---------PAMWFSQLPFLTAVQTQQGWAYAN 250
             ...|..||:|:.|...| |:...:|....||         ||.|  :|       .|:..|..|
  Rat   230 -CRVGLGICYDMRFAELA-QIYARRGCQLLVYPGAFNMTTGPAHW--EL-------LQRARAVDN 283

  Fly   251 DVNLLASGASRPSIGNSGSGIYHGRS-------------GTLTSVMRQDSGERAIYVAQVPKYTR 302
            .|.:   ..:.|:.....|.:..|.|             ||..:::..|     |.:.::.:..:
  Rat   284 QVYV---ATASPARDEKASYVAWGHSTVVDPWGQVLTKAGTEETILYSD-----IDLKKLSEIRQ 340

  Fly   303 SRSLKKRAKRSLQEIQTRQ 321
            ...:.|:.:..|..:::::
  Rat   341 QIPILKQKRADLYSVESKK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 66/305 (22%)
Nit2XP_038944121.1 nit 89..349 CDD:143596 64/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.