DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and Nit1

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_036179.1 Gene:Nit1 / 27045 MGIID:1350916 Length:323 Species:Mus musculus


Alignment Length:215 Identity:46/215 - (21%)
Similarity:87/215 - (40%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QSILSLSAWSDSLAGYVEIINSEN-----ASATDIIVFPESTLNSAGSTTFVPNPEDQI--NPC- 98
            :::.|.::|...|....::.::.|     .:..:::   :..........|:|...|.|  ||. 
Mouse    32 RTMSSSTSWELPLVAVCQVTSTPNKQENFKTCAELV---QEAARLGACLAFLPEAFDFIARNPAE 93

  Fly    99 ---LSDP-NATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVF 159
               ||:| |.    :.|...|..||....::.:. ...::.:|..::.:        ::|.:|:.
Mouse    94 TLLLSEPLNG----DLLGQYSQLARECGIWLSLG-GFHERGQDWEQNQK--------IYNCHVLL 145

  Fly   160 DRQGVVVSRYRKVHL-------YGEAKNSTFLPELITFE----TDFGVTFGHFICFDILFYTPAH 213
            :.:|.||:.|||.||       .|..:.|.:.....|.|    |..| ..|..||:|:.|  |..
Mouse   146 NSKGSVVASYRKTHLCDVEIPGQGPMRESNYTKPGGTLEPPVKTPAG-KVGLAICYDMRF--PEL 207

  Fly   214 QL-IVEQGITDFVYPAMWFS 232
            .| :.:.|.....||:.:.|
Mouse   208 SLKLAQAGAEILTYPSAFGS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 46/215 (21%)
Nit1NP_036179.1 nit 44..311 CDD:143596 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.