powered by:
Protein Alignment vanin-like and nft-1
DIOPT Version :9
Sequence 1: | NP_572297.1 |
Gene: | vanin-like / 31551 |
FlyBaseID: | FBgn0040069 |
Length: | 558 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499556.1 |
Gene: | nft-1 / 176628 |
WormBaseID: | WBGene00003594 |
Length: | 440 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 36/73 - (49%) |
Gaps: | 12/73 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 SNGLNVFNTNVVFDRQGVVVSRYRKVHLYG----------EAKNSTFLPELI-TFETDFGVTFGH 200
|:..:.:||:::.|..||..:.|.|:||:. |::.|....|:| ..:|..| ..|.
Worm 103 SDAAHPWNTHLIIDSDGVTRAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIG-RLGL 166
Fly 201 FICFDILF 208
.||:|:.|
Worm 167 SICYDVRF 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0388 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.