DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and upb-1

DIOPT Version :10

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_495261.1 Gene:upb-1 / 174040 WormBaseID:WBGene00017440 Length:387 Species:Caenorhabditis elegans


Alignment Length:180 Identity:42/180 - (23%)
Similarity:71/180 - (39%) Gaps:47/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VFNTNVVFDRQGVVVSRYRKVHL--YGEAKNSTFLPELI----TFETDFGVTFGHFICFDILFYT 210
            ::||.||....|.|:.|.||.|:  .|:...||:..|..    .|||.:| ..|..||:.  .:.
 Worm   179 IWNTAVVISHTGRVIGRSRKNHIPRVGDFNESTYYMESTLGHPVFETKYG-RIGINICYG--RHH 240

  Fly   211 PAHQLIVEQGITDFVY-PAMWFSQL--PFLTAVQTQQGWAYANDV--------------NLLASG 258
            |.:.::......:.:: |:.....|  | |..::.:.. |.||.|              |...||
 Worm   241 PQNWMMYALNGAEIIFNPSATVGALSEP-LWGIEARNA-AIANHVFTVGINRVGTEVFPNEFTSG 303

  Fly   259 ASRPSIGNSGSGIYHGRSGTLTSVMRQDSGERAIYVAQVPKYTRSRSLKK 308
            ..:|:  :...|.::|.|                |:| .|..:|:.:|.:
 Worm   304 NGQPA--HKDFGHFYGSS----------------YIA-APDGSRTPALSR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 41/174 (24%)
Vanin_C 328..512 CDD:465946
upb-1NP_495261.1 ML_beta-AS 11..373 CDD:143611 42/180 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.