DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vanin-like and Upb1

DIOPT Version :9

Sequence 1:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_598756.1 Gene:Upb1 / 103149 MGIID:2143535 Length:393 Species:Mus musculus


Alignment Length:116 Identity:28/116 - (24%)
Similarity:49/116 - (42%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EEFLVTLSC--AARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYR 170
            |:.|.|..|  .|:..:..:|..:.|:.:            .:|..::||.||....|:|:.:.|
Mouse   143 EDGLTTRFCQKLAKKHNMVVVSPILERDR------------EHGGVLWNTAVVISNSGLVMGKTR 195

  Fly   171 KVHL--YGEAKNSTFLPE----LITFETDFG-----VTFGHFICFDILFYT 210
            |.|:  .|:...||:..|    ...|:|.||     :.:|.....:.|.|:
Mouse   196 KNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 28/116 (24%)
Upb1NP_598756.1 PLN00202 6..392 CDD:177792 28/116 (24%)
ML_beta-AS 9..371 CDD:143611 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.