DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1T and Catsper3

DIOPT Version :9

Sequence 1:NP_001259267.1 Gene:Ca-alpha1T / 31550 FlyBaseID:FBgn0264386 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_001239416.1 Gene:Catsper3 / 76856 MGIID:1924106 Length:395 Species:Mus musculus


Alignment Length:349 Identity:89/349 - (25%)
Similarity:163/349 - (46%) Gaps:64/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2438 ENFHRCREEQEKEEKIRRAAKRALQ--MEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIA 2500
            ::||. ...:.|...:...|..|||  :.|.:|:..|         .:.:...|:.|.:|.:.:.
Mouse     3 QHFHH-NPVRVKSGSLFATASEALQARLSKIKRKDKE---------CQAYFRKVIKSTFFQIVMI 57

  Fly  2501 AVIGLNVVTMAM--------EYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRW 2557
            ..:..|...:.:        |:::       ..::...||.:|::.|..|| |.:....|.||.:
Mouse    58 TTVTTNSFLLVLGTNYDIQFEFFR-------TFEVSELFFVSVYVCEFLMK-VYVDPITYWKDGY 114

  Fly  2558 NQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQ 2622
            |.|||.|:::..:..:|.:::.|       :...:.....::..|:|||:..:.|||.|:..|.:
Mouse   115 NILDVIILIILTIPYLLRKIKGN-------HSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGE 172

  Fly  2623 ALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDN 2687
            .:..|.::..|.|||.|:||.||..|||   .:|.      |:..::.|...||.|||.:||.|.
Mouse   173 TVYTVASVLTLLFLLMFVFAILGFCLFG---VTDR------GDLENWGNLASAFFTLFSLATVDG 228

  Fly  2688 WNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQME 2752
            |..:.::..:          |...||..    |.::|:|:|.|:.:|:.|.|::.|.|:|.|:.|
Mouse   229 WTDLQEELDK----------RKFTVSRA----FTILFILLASFIFLNMFVGVMIMHTEDSMKKFE 279

  Fly  2753 DELDMEVEL----ERELV--REQE 2770
            .:|.:|..|    |::::  |:||
Mouse   280 RDLTLERNLAIMEEKQIILKRQQE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1TNP_001259267.1 Ion_trans 332..636 CDD:278921
Ion_trans 1261..1495 CDD:278921
Ion_trans 2192..2448 CDD:278921 2/9 (22%)
Ion_trans 2510..2728 CDD:278921 58/225 (26%)
Catsper3NP_001239416.1 Ion_trans 49..269 CDD:366146 66/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.