DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1T and CATSPER3

DIOPT Version :9

Sequence 1:NP_001259267.1 Gene:Ca-alpha1T / 31550 FlyBaseID:FBgn0264386 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_821138.1 Gene:CATSPER3 / 347732 HGNCID:20819 Length:398 Species:Homo sapiens


Alignment Length:368 Identity:103/368 - (27%)
Similarity:171/368 - (46%) Gaps:60/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  2465 KKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAM-EYYKMPSGLKYALKIF 2528
            ||.:|        |....|.||..|:.|::|.:.:.:.:..|...||: ..|.:...|...|:..
Human    30 KKFKR--------NDDECRAFVKRVIMSRFFKIIMISTVTSNAFFMALWTSYDIRYRLFRLLEFS 86

  Fly  2529 NYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIR 2593
            ..||.::...|.:|| |.:....|.|:.:|.|||.|:::..:...|.:|.....       |.:.
Human    87 EIFFVSICTSELSMK-VYVDPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQF-------TYLY 143

  Fly  2594 VMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEI 2658
            :...::..|:|||:..:.|||.|:..|.|.:..|.::.||.|||.:|||.||..|||..:     
Human   144 IADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASVLLLLFLLMYIFAILGFCLFGSPD----- 203

  Fly  2659 PCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVI 2723
                .|:|.::.|...||.|||.:||.|.|..:.|..  ||.:.|            ::..|.:|
Human   204 ----NGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQL--DNREFA------------LSRAFTII 250

  Fly  2724 FVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVEL----ERELV--REQE------FAQEQK 2776
            |:|:|.|:.:|:.|.|::.|.|:|.::.|.||.:|.:.    |::::  |:||      ..|:..
Human   251 FILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQRQQEEISRLMHIQKNA 315

  Fly  2777 LC---QQLAEAQSKAAAPPRPLAKVKSLPKNFIYSTPSLDKKF 2816
            .|   .:|.|...|..:...|:     :..:|..|.|.:|..|
Human   316 DCTSFSELVENFKKTLSHTDPM-----VLDDFGTSLPFIDIYF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1TNP_001259267.1 Ion_trans 332..636 CDD:278921
Ion_trans 1261..1495 CDD:278921
Ion_trans 2192..2448 CDD:278921
Ion_trans 2510..2728 CDD:278921 65/218 (30%)
CATSPER3NP_821138.1 Ion_trans 72..269 CDD:278921 68/227 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.