DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1T and Catsper4

DIOPT Version :9

Sequence 1:NP_001259267.1 Gene:Ca-alpha1T / 31550 FlyBaseID:FBgn0264386 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_808534.1 Gene:Catsper4 / 329954 MGIID:3043288 Length:442 Species:Mus musculus


Alignment Length:326 Identity:73/326 - (22%)
Similarity:142/326 - (43%) Gaps:58/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  2482 TRMFVHNVVTSKYFDLAIAAVIGLNVVTMAM--------EYYKMPSGLKYALKIFNYFFTAVFIL 2538
            |:|::..::....|.|.:|.::..|.:|:|:        ::|::.|.:       :.....:.|.
Mouse    57 TQMYIKQLLRHPAFQLLLAFLLLSNAITIALRTNSYLGQKHYELFSTI-------DDIVLTILIC 114

  Fly  2539 EANMKLVALGWK----LYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLR 2599
            |     |.|||.    ::.||.||.|:..||.:..:|..:::|:            ::.:...||
Mouse   115 E-----VLLGWLNGFWIFWKDGWNILNFAIVFILFMGFFIKQLD------------MVAITYPLR 162

  Fly  2600 IARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLG 2664
            :.|::.:......:..::..::|::|.:.|:..|......:|:..||.|||..     :|     
Mouse   163 VLRLVHVCMAVEPLARIIKVILQSMPDLANVMALILFFMLVFSVFGVTLFGAF-----VP----- 217

  Fly  2665 EHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQ 2729
              .||.|.|:|..|||...|.|.|..|..|...|..:.|.:         |...|:|.:|:.:..
Mouse   218 --KHFQNMGVALYTLFICITQDGWLDIYTDFQMDEREYAME---------VGGAIYFAVFITLGA 271

  Fly  2730 FVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKAAAPPRP 2794
            |:.:|:.|.|:..:||:..|..|:|..:.::. .|...::::..|..|.......:..:..|..|
Mouse   272 FIGLNLFVVVVTTNLEQMMKTGEEEGHLNIKF-TETEEDEDWTDELPLVHCTEARKDTSTVPKEP 335

  Fly  2795 L 2795
            |
Mouse   336 L 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1TNP_001259267.1 Ion_trans 332..636 CDD:278921
Ion_trans 1261..1495 CDD:278921
Ion_trans 2192..2448 CDD:278921
Ion_trans 2510..2728 CDD:278921 51/229 (22%)
Catsper4NP_808534.1 Ion_trans 91..289 CDD:278921 56/242 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.