DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1T and Catsper3

DIOPT Version :9

Sequence 1:NP_001259267.1 Gene:Ca-alpha1T / 31550 FlyBaseID:FBgn0264386 Length:3218 Species:Drosophila melanogaster
Sequence 2:XP_006253634.1 Gene:Catsper3 / 290989 RGDID:1305700 Length:395 Species:Rattus norvegicus


Alignment Length:300 Identity:82/300 - (27%)
Similarity:139/300 - (46%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  2485 FVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKY--------ALKIFNYFFTAVFILEAN 2541
            |...|..|..|.:       |.:.|:....:.:..|..|        ..:|...||.:::..|..
  Rat    42 FFRKVTKSTLFQI-------LMITTVTANSFLLVLGTNYDIHFRMFRVFEISELFFVSIYACEFL 99

  Fly  2542 MKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKL 2606
            || |.:....|.||.:|.|||.|:::..:...|.:::.|..:.:.....|       :..|||||
  Rat   100 MK-VYVDPITYWKDGYNILDVVILVIITIPYFLRKIKGNHFEYLHFADGI-------QSLRVLKL 156

  Fly  2607 LKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFAN 2671
            :..:.|||.|:..|.:.:..|.::..|.|||.|:||.||..|||..:         .|:..::.|
  Rat   157 ISYSRGIRTLIIAVGETVYTVASVLTLLFLLMFVFAILGFCLFGNAD---------RGDLTNWGN 212

  Fly  2672 FGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVV 2736
            ...||.|||.:||.|.|..:.::..:          |...||..    |.::|:|:|.|:.:|:.
  Rat   213 LAAAFFTLFSLATVDGWTNLQEELDK----------RKFTVSRA----FTILFILLASFIFLNMF 263

  Fly  2737 VAVLMKHLEESHKQMEDELDMEVEL----ERELV--REQE 2770
            |.|::.|.|:|.|:.|.|:.:|..|    |::::  |:|:
  Rat   264 VGVMIMHTEDSIKKFEREMTLERNLALMEEKQMILRRQQD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1TNP_001259267.1 Ion_trans 332..636 CDD:278921
Ion_trans 1261..1495 CDD:278921
Ion_trans 2192..2448 CDD:278921
Ion_trans 2510..2728 CDD:278921 60/225 (27%)
Catsper3XP_006253634.1 Ion_trans 73..269 CDD:278921 64/226 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.