DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1T and Catsper2

DIOPT Version :9

Sequence 1:NP_001259267.1 Gene:Ca-alpha1T / 31550 FlyBaseID:FBgn0264386 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_694715.2 Gene:Catsper2 / 212670 MGIID:2387404 Length:588 Species:Mus musculus


Alignment Length:348 Identity:81/348 - (23%)
Similarity:166/348 - (47%) Gaps:51/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  2448 EKEEKIRRAAK----------RALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAV 2502
            ::|:.:|.:.|          |.| :.:.|.|....|      |..::...|:.|..|...|.::
Mouse    58 DQEQLVRFSIKPRRMGHITHSRRL-LSRLRVRCSRMP------PLSLWAGWVLDSSVFSKFIISL 115

  Fly  2503 IGLNVVTMAMEYYKMPS------GLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLD 2561
            |.||...:.:|...|.|      .:|.||::.::|....||:|..:..:| .:.|:.||.||..|
Mouse   116 IFLNTFVLMVEIELMESTNTALWPVKLALEVADWFILLSFIVEILLMWLA-SFSLFWKDAWNVFD 179

  Fly  2562 VGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQ 2626
            ..:.|||::..::..|.      :|.:...::::||.|:.|.|||......|:.:|..:::||..
Mouse   180 FFVTLLSLLPELVVLLG------VPAHSVWLQLLRVCRVLRSLKLFARFRQIKVILLALVRALKS 238

  Fly  2627 VGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGI 2691
            :..|.:|..:.|:|||..||..|.....|   ..:||..:..|::...:.:|:|.:.|.|:|..:
Mouse   239 MTFLLMLLLIFFYIFAVTGVYFFREYSRS---TIEGLEYNMFFSDLLNSLVTVFILFTLDHWYAV 300

  Fly  2692 MKDTLRDNCDDAADCVRNCCV---SSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMED 2753
            ::|..:              |   |.|.:.|:.::::|:...:..|::||:::.:.:....::.:
Mouse   301 LQDIWK--------------VPESSRVFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRSELSE 351

  Fly  2754 ELD-MEVELERELVREQEFAQEQ 2775
            |:. :||:.:.::.::|...:.|
Mouse   352 EMSHLEVQYKADMFKQQIIQRRQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1TNP_001259267.1 Ion_trans 332..636 CDD:278921
Ion_trans 1261..1495 CDD:278921
Ion_trans 2192..2448 CDD:278921 81/348 (23%)
Ion_trans 2510..2728 CDD:278921 57/226 (25%)
Catsper2NP_694715.2 Ion_trans 105..350 CDD:366146 66/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.