DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nep1 and nep-15

DIOPT Version :9

Sequence 1:NP_001284925.1 Gene:Nep1 / 31547 FlyBaseID:FBgn0029843 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001257056.2 Gene:nep-15 / 185513 WormBaseID:WBGene00018227 Length:267 Species:Caenorhabditis elegans


Alignment Length:274 Identity:68/274 - (24%)
Similarity:111/274 - (40%) Gaps:77/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 YVNLTIVP-DNFINNVLSILQWESEKMLRLLRQPVDKEKWTTEPAVVNAFYNPNKNDIVFPAGIL 660
            |||.::.| :||..:..|.                |..:.....|:.|..|...:..        
 Worm    31 YVNKSVCPCENFYRHACSF----------------DSPRNLMATALKNLTYELRQKQ-------- 71

  Fly   661 QPLFYSQHFPKSLNYGGIGVVIGHEITHGF--DDKGRQFDKEGNMMQWWNNATIEAFRERTQ-CV 722
            ..||:: |....|.:.|..|  ||||.|.|  :..|...              :..|.|..: ||
 Worm    72 ADLFWN-HITLVLGFTGFSV--GHEIGHSFFANHSGTDI--------------LPYFSENVEKCV 119

  Fly   723 IDQY----SRYKINEVDMFMDGRMTQGENIADNG----GLKQAFRAYKKWETLHGR-EQQLPGLN 778
            .:|:    :.||       .:..:|:.|.:.|||    ||:.|::..:|:  |.|| |:::..||
 Worm   120 QNQFNSTCNEYK-------EESCVTRNEMLDDNGADIFGLQLAYKLMEKY--LSGRLEERIERLN 175

  Fly   779 MTHDQLFFLNYAQIWCGSMRPEDALTKI------RSAVHSPGFVRVLGPLSNSRDFASAYKCPLG 837
            :|.:||||.::|..:|..     :|:|:      ....||...||| ..::....|..|:.||..
 Worm   176 VTQEQLFFYSFANQFCSG-----SLSKVFIEEEGDYDPHSVNNVRV-NAVAQHPGFRKAFNCPDN 234

  Fly   838 STM--NPAEKCSVW 849
            |.|  :..|:|.::
 Worm   235 SRMMKSATEQCIIY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nep1NP_001284925.1 M13 194..847 CDD:189000 67/270 (25%)
nep-15NP_001257056.2 GluZincin <87..237 CDD:387391 50/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.