DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4660 and them6

DIOPT Version :9

Sequence 1:NP_572293.1 Gene:CG4660 / 31542 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001116176.1 Gene:them6 / 569944 ZFINID:ZDB-GENE-070912-340 Length:205 Species:Danio rerio


Alignment Length:259 Identity:73/259 - (28%)
Similarity:110/259 - (42%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLL 65
            ||.:....:.|||   :::..|::.|:||..|.|..|.|:.....:....|.:|..:.||:|  |
Zfish     1 MEDVLLWVVGVLL---LLFCTLDVWYYLRAVLVVTKAWFLSPVFDVTGEQTASGRVVLNDID--L 60

  Fly    66 YHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWD 130
            .|||||||.||.||||:..|.|..:::.:..:|.:...||.||||||.:.....|.:.|||:.||
Zfish    61 CHMNNARYLRECDFARLSLYTRNGVFKALRALGATAVVGATTIRYRRPLCVGEAFELRSRIVSWD 125

  Fly   131 EQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAG 195
            |:|.::|.|||...|..|..:..|:|.|:..:.:.::..|..|                      
Zfish   126 EKSFYLEQRFVSCKDGMVSAVMFCKQNVLRSTPDKILQYLCKR---------------------- 168

  Fly   196 GISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLK-PSLPPELAKWIEYNDMSSKNLR 258
                                                  |:: |..|.:|..||.:...|||.||
Zfish   169 --------------------------------------KVEVPEFPEDLQHWINFITASSKALR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 45/105 (43%)
them6NP_001116176.1 4HBT_2 53..183 CDD:290018 51/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581718
Domainoid 1 1.000 97 1.000 Domainoid score I7172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm6532
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - O PTHR12475
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.