DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4660 and THEM6

DIOPT Version :9

Sequence 1:NP_572293.1 Gene:CG4660 / 31542 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_057731.1 Gene:THEM6 / 51337 HGNCID:29656 Length:208 Species:Homo sapiens


Alignment Length:252 Identity:71/252 - (28%)
Similarity:105/252 - (41%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSVLLAI-IVVYGLLELHYFLRMCLCVLLARFVKRRCH-ILDTTTVNGLCLTNDVDTLLYHMNNA 71
            |..|||: :.|:.||::.|.:|:...||.||.::.|.. :|......|..|.:|:| ||.|||||
Human     5 LVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLD-LLLHMNNA 68

  Fly    72 RYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDEQSLFM 136
            ||.||.|||||....|..:...:..:.......|:..|:||.:|....|.:.:|::.||:::.::
Human    69 RYLREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVRTRLLGWDDRAFYL 133

  Fly   137 EHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGGISNPA 201
            |.|||...|.||..:...||.::..|.|.|:..|..|...                         
Human   134 EARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVE------------------------- 173

  Fly   202 MDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLR 258
                                              .|.||.:|..||.||:.||:.||
Human   174 ----------------------------------PPELPADLQHWISYNEASSQLLR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 38/105 (36%)
THEM6NP_057731.1 4HBT_2 54..185 CDD:315859 47/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147848
Domainoid 1 1.000 92 1.000 Domainoid score I7612
eggNOG 1 0.900 - - E1_KOG4366
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4743
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - otm40591
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - LDO PTHR12475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.