DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4660 and Them6

DIOPT Version :9

Sequence 1:NP_572293.1 Gene:CG4660 / 31542 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001007659.1 Gene:Them6 / 300015 RGDID:1359378 Length:207 Species:Rattus norvegicus


Alignment Length:260 Identity:73/260 - (28%)
Similarity:108/260 - (41%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCH-ILDTTTVNGLCLTNDVDTL 64
            |.:|..::||:.||.   :.||:..|.:|:...||.||.::.|.. :|......|..|.:|:| |
  Rat     1 MMELLVVSLSLALAF---FALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQLYAGRVLPSDLD-L 61

  Fly    65 LYHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYW 129
            |.|||||||.||.|.||.....|..:...:..:|......|:..||||.:|.|..|.:.:|::.|
  Rat    62 LLHMNNARYLREADVARAAHLTRCGVLGALRDLGAHTVLAASCARYRRSLRLFEPFEVHTRLLGW 126

  Fly   130 DEQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAA 194
            |:::.::|.|||...|.||..:...||.|:..|.:.|:..|..|...                  
  Rat   127 DDRAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRVVQHLCKRRVE------------------ 173

  Fly   195 GGISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                                     .|.||.:|..||.||:.||:.||:
  Rat   174 -----------------------------------------PPELPEDLKHWITYNETSSQLLRA 197

  Fly   260  259
              Rat   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 40/105 (38%)
Them6NP_001007659.1 4HBT_2 54..185 CDD:404206 48/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341705
Domainoid 1 1.000 91 1.000 Domainoid score I7530
eggNOG 1 0.900 - - E1_KOG4366
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4703
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - otm44732
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - LDO PTHR12475
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.