DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4660 and si:ch73-52e5.2

DIOPT Version :9

Sequence 1:NP_572293.1 Gene:CG4660 / 31542 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017212901.1 Gene:si:ch73-52e5.2 / 100142654 ZFINID:ZDB-GENE-070912-341 Length:207 Species:Danio rerio


Alignment Length:258 Identity:71/258 - (27%)
Similarity:106/258 - (41%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCY--LALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLLY 66
            :|:  :.|..|...::::|..::.||||.....|...|......:|....|:|..|.:|:| .:.
Zfish     1 MCHRIMLLWFLSGSLLLFGTFDVWYFLRGLWVALRCCFQSPIRDVLAEQVVHGRVLLHDMD-FMC 64

  Fly    67 HMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDE 131
            |||||||.||.||||.....|..|:.....:..::..||.||||||.:.....|.:.:||:.|||
Zfish    65 HMNNARYLRECDFARFAHGTRIGLFMAARALKATMVVGATTIRYRRSLALGEGFELRTRIVSWDE 129

  Fly   132 QSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGG 196
            :|.::|.|||..||.|:..:.:|||.||..|.:.::..|..|                       
Zfish   130 KSFYLEQRFVSKSDGFISAVMLCRQNVIRGSPQNILEFLCKR----------------------- 171

  Fly   197 ISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                            ...|    |.:..||..||.:...||:.||:
Zfish   172 --------------------------------KVDC----PDISEELQHWIRFISASSQALRA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 45/105 (43%)
si:ch73-52e5.2XP_017212901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581720
Domainoid 1 1.000 97 1.000 Domainoid score I7172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm6532
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - LDO PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.