DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and YBR096W

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_009654.3 Gene:YBR096W / 852393 SGDID:S000000300 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:48/213 - (22%)
Similarity:88/213 - (41%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WL--VVLLILYVIWDVNYFIRCVFTV--------FAGRLFQRKRKVTDTTTIYGLCTSQDVDI-- 55
            ||  ..||..|......||:|..:.|        |.|...:..:|:....  ||..:...:|.  
Yeast     9 WLFAAYLLSSYKSLPGAYFVRFYYYVIQNLFLPMFTGFETENIKKLEKNE--YGCFSYTSLDTYA 71

  Fly    56 ------FIRHMNNARYLRELDFARFHFYALTGLYER--IRDRRGGAVQGAS-SVRYRRTIPIFHP 111
                  |..|.:|:.|..|||.:|.:.  :..::::  :..:....:..|: ...:.:.|..|..
Yeast    72 SPFECDFYFHKSNSTYFAELDISRGNL--MCKIFQKLMLNSKHYPYIPVANVFTNFLKEIKPFQK 134

  Fly   112 YKIQTKLIWWDDKAIYLEQQFITLSDGFVRAVAMSKQNITNCNVLEVLKTYPETAQRPEKPEELK 176
            |.:.:::|.||:|.||:..:| |:..|.|.           |: |.:.|...:..::..||:   
Yeast   135 YSVSSRIICWDEKWIYVMSRF-TIKKGTVL-----------CS-LSLTKYVLKDGRKTIKPK--- 183

  Fly   177 LWLDAIE---LSSQKLRK 191
               ||:|   |.::|:.|
Yeast   184 ---DALEYCGLYNEKVAK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 28/141 (20%)
YBR096WNP_009654.3 4HBT 73..175 CDD:238329 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4781
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.