DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4666 and them6

DIOPT Version :9

Sequence 1:NP_001284923.1 Gene:CG4666 / 31541 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001116176.1 Gene:them6 / 569944 ZFINID:ZDB-GENE-070912-340 Length:205 Species:Danio rerio


Alignment Length:196 Identity:75/196 - (38%)
Similarity:114/196 - (58%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WLV-VLLILYVIWDVNYFIRCVFTV----FAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMNN 62
            |:| |||:|:...||.|::|.|..|    |...:|.    ||...|..|.....|:|:.  ||||
Zfish     7 WVVGVLLLLFCTLDVWYYLRAVLVVTKAWFLSPVFD----VTGEQTASGRVVLNDIDLC--HMNN 65

  Fly    63 ARYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIY 127
            ||||||.||||...|...|:::.:|.....||.||:::||||.:.:...::::::::.||:|:.|
Zfish    66 ARYLRECDFARLSLYTRNGVFKALRALGATAVVGATTIRYRRPLCVGEAFELRSRIVSWDEKSFY 130

  Fly   128 LEQQFITLSDGFVRAVAMSKQNI---TNCNVLEVLKTYPETAQRPEKPEELKLWLDAIELSSQKL 189
            |||:|::..||.|.||...|||:   |...:|:.|  .....:.||.||:|:.|::.|..||:.|
Zfish   131 LEQRFVSCKDGMVSAVMFCKQNVLRSTPDKILQYL--CKRKVEVPEFPEDLQHWINFITASSKAL 193

  Fly   190 R 190
            |
Zfish   194 R 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:404206 51/133 (38%)
them6NP_001116176.1 4HBT_2 53..183 CDD:290018 51/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581719
Domainoid 1 1.000 97 1.000 Domainoid score I7172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105296
Inparanoid 1 1.050 129 1.000 Inparanoid score I4632
OMA 1 1.010 - - QHG59462
OrthoDB 1 1.010 - - D1195870at2759
OrthoFinder 1 1.000 - - FOG0003421
OrthoInspector 1 1.000 - - mtm6532
orthoMCL 1 0.900 - - OOG6_106004
Panther 1 1.100 - - O PTHR12475
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.